![[Feedback]](/icons/banner/feedbackACT.gif){kind=icon}
![[For Subscribers]](/icons/banner/subscriberACT.gif){kind=icon}
![[Archive]](/icons/banner/archiveACT.gif){kind=icon}
![[Search]](/icons/banner/searchACT.gif){kind=icon}
![[Contents]](/icons/banner/tocACT.gif){kind=icon}
|
|
|
|
|
||
A Berkovich, P McPhie, M Campagnone, A Guidotti and P Hensley
Fidia-Georgetown Institute for the Neurosciences, Washington, DC 20007.
Synthetic peptides related to triakontatetraneuropeptide (TTN) [17TQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLK50; diazepam binding inhibitor (DBI) 17-50], a natural brain processing product of rat DBI, were analyzed for their physicochemical and ligand-receptor interaction characteristics. The ability of TTN and TTN-related fragments to displace [3H]flumazenil (ethyl-8-fluoro-5,6-dihydro-5-methyl-6-oxo-4H- imidazol[1,5a] [1,4]-benzodiazepine-3-carboxylate) or [3H]Ro 5-4864 [7- chloro-1,3-dihydro-1-methyl-5-(p-chlorophenyl)-2H-1, 4-benzodiazepine-2- one] from their respective benzodiazepine (BZ) binding site subtypes was tested in intact cerebellar culture neurons or in homogenates of cultured astrocytes. These studies indicate that the C-terminal region of TTN, which is also present in DBI 22-50, eicosapentaneuropeptide (DBI 26-50), and octadecaneuropeptide (ODN) (DBI 33-50), but not in DBI 19-41, is essential for interaction with the BZ recognition sites. When the C-terminal lysine of ODN is blocked with an NH2 group, the ability of ODN to interact with the binding of [3H]flumazenil is lost. A comparison analysis of the binding data with the secondary structure characteristics of the peptides demonstrated that TTN (DBI 17-50) and DBI 22-50, which have hydrophobic portions and marked tendencies to produce alpha-helicity, specifically displace (apparent Ki, 5-6 microM) [3H] Ro 5-4864 from astroglial cell binding sites. Peptides (ODN, eicosapentaneuropeptide, OND-NH2) with very low tendencies to form alpha-helices and with virtually no hydrophobic structure were not able to displace Ro 5-4864 at concentrations of up to 100 microM. In contrast, ODN was a good displacer of [3H]flumazenil from intact neurons, with an apparent IC50 of 5 microM. These data suggest that the alpha-helical portion of TTN may be important for BZ receptor recognition and BZ receptor subtype discrimination.
This article has been cited by other articles:
|
|
 |
|
  N. H. Barmack, T. R. Bilderback, H. Liu, Z. Qian, and V. Yakhnitsa Activity-Dependent Expression of Acyl-Coenzyme A-Binding Protein in Retinal Muller Glial Cells Evoked by Optokinetic Stimulation J. Neurosci., February 4, 2004; 24(5): 1023 - 1033. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 C. Duparc, H. Lefebvre, M.-C. Tonon, H. Vaudry, and J.-M. Kuhn Characterization of Endozepines in the Human Testicular Tissue: Effect of Triakontatetraneuropeptide on Testosterone Secretion J. Clin. Endocrinol. Metab., November 1, 2003; 88(11): 5521 - 5528. [Abstract] [Full Text] [PDF]
|
|
|
|
 |
|
 O. Lesouhaitier, M. K. Kodjo, F. Cartier, V. Contesse, L. Yon, C. Delarue, and H. Vaudry The Effect of the Endozepine Triakontatetraneuropeptide on Corticosteroid Secretion by the Frog Adrenal Gland Is Mediated by Activation of Adenylyl Cyclase and Calcium Influx through T-Type Calcium Channels Endocrinology, January 1, 2000; 141(1): 197 - 207. [Abstract] [Full Text] [PDF]
|
|
 |
 |
 |
|
 |
 |
 |
