QUICK SEARCH:   [advanced] Author: Keyword(s): Year:  Vol:  Page:

This Article Full Text Full Text (PDF) All Versions of this Article: mol.105.021444v1 69/6/2037    most recent Submit a response Alert me when this article is cited Alert me when eLetters are posted Alert me if a correction is posted Services Similar articles in this journal Similar articles in PubMed Alert me to new issues of the journal Download to citation manager Citing Articles Citing Articles via Google Scholar Google Scholar Articles by Pochet, S. Articles by Dehaye, J.-P. Search for Related Content PubMed PubMed Citation Articles by Pochet, S. Articles by Dehaye, J.-P.

Modulation by LL-37 of the Responses of Salivary Glands to Purinergic Agonists

Laboratoires de Biochimie et de Biologie Cellulaire (S.P., S.T., S.Q., M.D.L., J.-P.D.) and Microbiologie, Institute of Pharmacy, Université libre de Bruxelles, Brussels, Belgium (M.T.-H., M.D.); Unité de Recherche sur la Structure et la Fonction des Membranes Biologiques, Faculty of Sciences, Université libre de Bruxelles, Brussels, Belgium (M.V.); and Departamento de Bioquimica y Biologia Molecular, Facultad de Ciencias, Universidad del Pais Vasco, Bilbao, Spain (M.G.-M., A.M.)

The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A₂ (PLA₂). The small release of ATP induced by LL-37 could not account for this stimulation because apyrase did not significantly block the response to LL-37. The divalent cation magnesium inhibited the response to LL-37, but this inhibition was probably nonspecific because it also inhibited the in vitro bacteriostatic effect of the peptide. The increase of calcium uptake by LL-37 was not affected by 1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenylpiperazine (KN-62), a rather specific inhibitor of P2X₇ receptors in mice. LL-37 also increased [Ca²⁺]_i in cells from mice invalidated for these receptors. LL-37 had no effect on the response to carbachol. It inhibited the increase of [Ca²⁺]_i and the activation of phospholipase D by ATP. It potentiated the activation of the PLA₂ by the nucleotide. Finally, LL-37 increased the fluidity of the plasma membrane of submandibular gland cells. In conclusion, our results suggest that LL-37 is an autocrine regulator of submandibular gland cells. It does not stimulate mouse P2X₇ receptors but modulates their responses.

Address correspondence to: Dr. J. P. Dehaye, Laboratoire de Biochimie et de Biologie Cellulaire, Université libre de Bruxelles-Institut de Pharmacie C.P. 205/3, Boulevard du Triomphe, B1050 Bruxelles, Belgium. E-mail: jdehaye{at}ulb.ac.be