|
|
|
|
Vol. 58, Issue 1, 1-10, July 2000
Department of Pharmacology, School of Medicine, University of North Carolina, Chapel Hill, North Carolina
| |
Abstract |
|---|
|
|
|---|
The ability to selectively regulate the expression of genes implicated in cancer or other diseases could have important ramifications for both basic research and for therapy. Using peptide combinatorial libraries expressed in yeast, we have screened for novel zinc finger proteins that selectively bind to an overlapping EGR1/SP1/WT1 regulatory site in the promoter of the MDR1 multidrug resistance gene. The novel proteins were only moderately effective in blocking transcription by simple masking of the target site. However, when coupled to mammalian transactivator or repressor domains, they could selectively modulate the expression of reporter genes having promoters containing the MDR1 target site. Moreover, they could also regulate transcription of the chromosomal MDR1 gene. Thus, in K562 cells, 12-O-tetradecanoylphorbol-13-acetate-inducible expression of P-glycoprotein, the product of MDR1 gene, was strongly and selectively inhibited by the presence of a repressor protein targeted to the MDR1 promoter. These studies potentially provide a novel alternative approach to the control of multidrug resistance. They also provide important insights into strategies for developing selective regulators of gene expression.
| |
Introduction |
|---|
|
|
|---|
Selective
modulation of the transcription of disease-related genes potentially
offers an interesting alternative to conventional drug-based
therapeutics. Transcription factors generally have modular structures
with distinct DNA-binding and transregulator domains. These domains can
often be interchanged to generate new artificial activators or
repressors of gene expression. An important property of transcription
factors is their ability to engage in highly precise DNA recognition.
Recently it has become possible to design proteins with novel and
specific DNA binding abilities through the use of combinatorial library
screening approaches (Choo and Klug, 1994
; Choo et al., 1994
).
A simple structure for generation of new DNA-binding domains is
provided by the Cys2-His2
family of zinc fingers. Important members of this family include the
three-finger DNA-binding domains of the mouse and human transcription
factors Zif268 (Christy et al., 1988
) and SP1 (Kadonaga et al., 1987
),
respectively. Crystallographic analysis indicates that the
Cys2-His2 zinc finger
domain consists of ~30 amino acids, forms a simple fold, and
typically binds 3 base pairs of double-stranded DNA sequence (Pavletich
and Pabo, 1991
, 1993
; Fairall et al., 1993
; Elrod-Erickson et al.,
1996
). Only several crucial residues in each finger are involved in
base contacts. The DNA binding affinity and specificity of zinc fingers can be altered when these residues are varied, suggesting that zinc
fingers can be used for generation of proteins with novel DNA binding
specificities. Indeed, use of phage display combinatorial libraries has
allowed the selection of novel zinc finger peptides that can bind to
target DNA sequences in vitro (Choo and Klug, 1994
; Jamieson et al.,
1994
; Rebar and Pabo, 1994
; Wu et al., 1995
; Greisman and Pabo, 1997
;
Isalan et al., 1998
). Some of these novel zinc fingers (as three-finger
or polyfinger peptides, as well as linked to different repressor or
transactivation domains) were also functional in mammalian cells, as
indicated by reporter gene assays (Choo et al., 1997
; Kim and Pabo,
1997
, 1998
; Liu et al., 1997
; Beerli et al., 1998
).
Recently we described a yeast one-hybrid system that could be used as
an alternative approach for screening peptide combinatorial libraries
for double-stranded DNA recognition (Cheng et al., 1997
). In contrast
to phage display techniques, this strategy allows direct selection of
peptides that are able to recognize DNA in vivo within the cellular
context. The creation of proteins with novel DNA-binding affinities,
using either phage or yeast-based techniques, may be very useful for
the selective modulation of gene expression in experimental biology, as
well as in therapeutics. However, many issues need to be resolved
before this strategy can be effectively implemented.
In this study, we evaluated the possibility of regulating expression of
the MDR1 gene by design of artificial transcription factors using the
yeast combinatorial library approach. MDR1 was chosen as a challenging
and important model for cancer-related genes. The human MDR1 gene
encodes the P-glycoprotein, a 170-kDa membrane ATPase that can
transport many types of drugs from cells. Increased levels of
P-glycoprotein expression in tumor cells results in the phenomenon of
multidrug resistance, a significant problem for cancer chemotherapy
(Roninson, 1992
; Bradley and Ling, 1994
; Ambudkar et al., 1999
).
Multidrug resistance can be modulated by pharmacological agents that
interfere with P-glycoprotein function; some of these agents are
currently in clinical trials (Ambudkar et al., 1999
). However,
inhibition of P-glycoprotein expression offers an alternative strategy
that may be valuable in some circumstances. Overexpression of
P-glycoprotein is associated with increased levels of MDR1
transcription (for low levels of drug resistance) or with MDR1 gene
amplification (for high levels of resistance). The promoter of the MDR1
gene can be regulated by several transcription factors. In particular,
the SP1 transcription factor binds to the MDR1 promoter, and deletion
of an SP1-binding site results in reduction of transcription in
drug-resistant cells (Cornwell and Smith, 1993
). In some cell types,
this site is also involved in regulation by the EGR1 transcription
factor and by the Wilms' tumor suppressor protein, WT1 (McCoy et al.,
1995
; McCoy et al., 1999
). These results suggest that the EGR1/SP1/WT1
site is functionally significant for regulation of MDR1 gene expression
and represents a potential therapeutic target.
In this study we used the yeast combinatorial library approach to develop a DNA-interacting module that binds selectively to the MDR1 promoter, overlapping the EGR1/SP1/WT1 site. This module might then interfere with MDR1 expression in mammalian cells by mass action competition with endogenous transcription factors; alternatively, it might be used to anchor functional repressor domains, thereby inhibiting MDR1 transcription. Following this concept, we have assembled novel four and five zinc finger modules that specifically bind to the MDR1 promoter, but not to consensus SP1 sites, as indicated by reporter gene assays in yeast and mammalian cells. These proteins were only moderately effective in blocking transcription by simple masking of the target site. However, when linked to a KRAB-A repression domain, they significantly inhibited expression of reporter constructs having promoters containing the MDR1 site. Moreover, a novel five-finger repressor protein was able to inhibit inducible expression of P-glycoprotein from the chromosomal MDR1 gene. These observations suggest that it may be possible to use the yeast combinatorial library strategy to create therapeutically effective regulators of MDR1 and other cancer-related genes.
| |
Materials and Methods |
|---|
|
|
|---|
Strains and Cells.
Yeast strain yWAM2 (MATa
gal4
gal180 URA3:GAL1-lacZ
lys2801amber his3-
200
trp1-
63 leu2
ade2-101ochre CYH2) was
provided by Dr. P. Hieter (Johns Hopkins, Baltimore, MD) (Sikorski and
Hieter, 1989
). Yeast strain yM4271 (MATa ura-52 his3-200 ade2-101 lys2-801
leu2-3 112 trp1-903 tyr1-501) was
purchased from Clontech (Palo Alto, CA). DH10B Escherichia
coli competent cells were obtained from Life Technologies,
GibcoBRL (Gaithersburg, MD). Mammalian KB-8-5 cells, resistant to
colchicine, were a gift of Dr. M. Cornwell (Fred Hutchinson Cancer
Research Center, Seattle, WA) (Shen et al., 1986
). K562 cells were from
the Lineberger Comprehensive Cancer Center (University of North
Carolina, Chapel Hill, NC).
Library Construction.
The framework for selection of new
zinc finger peptides in the yeast one-hybrid system was synthesized by
polymerase chain reaction using six overlapping
oligonucleotides. It consists of two wild-type fingers from Zif268, ZF2
and ZF3, and a portion of ZF1 (
ZF1), in which eight residues were
deleted, including all residues responsible for base contacts (Fig.
1A). In addition, a few substitutions
were introduced into the nucleotide sequence (but not the amino acid
sequence) to generate restriction sites for DNA manipulations. This
framework was cloned into the EcoRI and NotI
restriction sites of the pXC yeast shuttle vector (Cheng et al., 1997
)
and the resulting plasmid was named pXCZ23. The pXC plasmid was
especially designed for expression of yeast combinatorial libraries and
selection of new DNA binding peptides. In that vector, in frame fusions
result in expression of chimeric proteins that consist of a GAL4
transactivating domain (N-terminal) connected by a "spacer" domain
to library peptides (potential DNA-binding domains).
|
|
Construction of Polyfinger Peptides.
Polyfinger peptides
were generated from the pLR2-1 plasmid by insertion of additional zinc
fingers downstream of ZF2 (see Fig. 3B).
To design the four-finger peptide (p4F), ZF3 was inserted. Five-finger
proteins were constructed by insertion of zinc fingers 3 and 2 (SF2 and
SF3) of the SP1 transcription factor. Two variants of five-finger
proteins were designed: 1) in the p5FS construct, the two fingers of
SP1 were connected to the other three fingers by a standard (or short)
linker, TGEKP, that is conserved in most Zifs found in nature; in a
second construct, p5FL, the fingers were connected with a longer
linker, TGEKGGGGERP. The glycine residues were introduced to allow free
rotation of the two sets of fingers with respect to each other. The
length of this linker was chosen on the basis of previous experience in
designing polyfinger proteins by another group (Kim and Pabo, 1998
).
Each linker starts from the last residue (Thr) of the helical region in
one finger, and ends at the proline residue, which is immediately
followed by the first
-sheet in the next finger. Detailed
descriptions of the construction of these plasmids (as well as all
constructions presented below) are available on request.
|
Yeast Reporter Plasmids.
Yeast reporters were generated by
insertion of target sites upstream of lacZ or
HIS3 reporter genes encoded by the pLG670Z (West et al.,
1984
) and the pRS315HIS-Km [derivative of pRS315HIS (Wang and Reed,
1993
)] yeast shuttle vectors, respectively. Target sites contained
multiple copies of an SP1 consensus sequence (W4) or MDR1 sequences
(3xMDR) (Fig. 2A) or single copies of SP1, or five (MDR5) or
four (MDR4) triplet sequences of MDR1 (Fig. 3A). Reporter constructions
were named W4-HIS, 3xMDR-HIS, SP1-HIS, MDR5-HIS, MDR4-HIS,
W4-lacZ, 3xMDR-lacZ, SP1-lacZ,
MDR5-lacZ, and introduced into the yeast strains yWAM2
(HIS-reporters) or yM4271(lacZ reporters).
Screening the Libraries.
The yeast one-hybrid system was
used for selection of peptides able to bind the target sequence. This
approach is based on use of his3
yeast cells containing a reporter plasmid with a target site inserted
upstream minimal promoter of the HIS3 gene (Wang and Reed,
1993
). The minimal promoter of the reporter is not sufficient to rescue
the his3
phenotype. However,
cotransfection of the recipient strain with a plasmid expressing the
GAL4 activation domain fused to a peptide that can bind to the target
sequence will result in transcription of HIS3, and selection
of his3+ positive yeast clones.
Screening of the LR1 and LR2 libraries, expressing zinc finger peptides
fused to the GAL4 transactivation domain, were performed in
his3
yWAM2 yeast cells containing
the 3xMDR-HIS reporter. Yeast cells were transformed with LR1 or LR2
libraries and plated onto selective medium lacking histidine, leucine,
and tryptophan and supplemented with 3.0 (for LR1) or 0.1 (for LR2) mM
3-amino-1,2,4 triazole (3-AT), which is an inhibitor of the histidine
pathway. After two days of incubation, strong positive clones were
selected for further study. In experiments where analysis of
lacZ gene expression was performed, yeast cells were plated
onto complete YPD medium supplemented with 0.2 mM X-Gal.
Mammalian Plasmid Constructions.
Mammalian constructions
(pcZF series) were designed on the basis of the pcDNA3.1(
)/Myc-HisA
vector (Stratagene, La Jolla, CA). The resulting plasmids expressed
zinc finger peptides flanked at the N termini with a nuclear
localization signal [NLS, TAT protein, amino acids 37 through 60 (Ruben et al., 1989
)] and at the C termini with a Myc epitope and a
polyhistidine tag (Fig. 5A). The N-terminal sequence reads
MASCFITKALGISYGRKKRRQRRRPPQEFM30... , where the TAT portion is bold face, the NLS is underlined, and the
zinc finger peptide starts from Met30. Plasmids
expressing three-finger peptides (SF3-SF2-SF1, ZF3-ZF2-NF1 and
ZF2-NF1-NF2), four-finger peptide (ZF3-ZF2-NF1-NF2), and five-finger peptide (SF3-SF2-long linker- ZF2-NF1-NF2) were named pcSP1, pc3F1, pc3F2, pc4F, and pc5F, respectively.
88/+105
reporter was provided by Dr. M. Cornwell (Cornwell and Smith, 1993Transient Cotransfection.
KB-8-5 cells were cultured under
the conditions described (Shen et al., 1986
). Cells were cotransfected
with 1 µg of reporter plasmid, 0.5 µg of peptide expression plasmid
and 0.1 µg of renilla luciferase plasmid (pRL-TK; Promega, Madison,
WI) using the LipofectAmine reagent according to the manufacturer's
recommendations (Life Technologies, GibcoBRL). To reduce the activation
of reporter genes by unknown factors, the concentration of serum was
reduced to 1%. K562 cells were transfected by electroporation as
described (McCoy et al., 1999
) with 10 µg of expression plasmid and 5 µg of pGreen Lantern-1 (Life Technologies, GibcoBRL) expressing green fluorescent protein (GFP) to mark transfected cells. After 18 h of
incubation 12-O-tetradecanoylphorbol-13-acetate (TPA) was added to a final concentration of 16 nM. Flow cytometry analysis was
performed after an additional 30 h of incubation.
Flow Cytometry Assay.
The flow cytometry assay has been
previously described (Alahari et al., 1996
). The MRK16
anti-P-glycoprotein antibody (Kamiya Biochemicals, Thousand Oaks, CA)
and the MAB1999
anti-
5
1 integrin antibody (Chemicon International, Inc., Temecula, CA) were used as
primary antibodies. An R-PE-conjugated goat anti-mouse IgG (Sigma
Chemical, St. Louis, MO) was used as the second antibody.
-Galactosidase and Luciferase Assays.
Quantitative
determination of
-galactosidase activity was performed with the
Luminescent
-galactosidase Genetic Reporter System II (Clontech).
Data were normalized per total amount of yeast proteins, determined
using the BCA protein assay (Pierce, Rockford, IL). Luciferase activity
was determined with the Dual-LuciferaseTM Reporter Assay System
(Promega), and data were normalized per renilla luciferase activity,
used as an internal control. Measurements of all activities were
performed on Monolight 2010 instrument (Analytical Luminescence
Laboratory, San Diego, CA).
| |
Results |
|---|
|
|
|---|
Selection of New Zinc Fingers that Bind to a Sequence Overlapping the SP1 Site in the MDR1 Promoter. To design new zinc finger proteins specific for the MDR1 promoter, we used Zif268 as a framework. We chose Zif268 because the MDR1 promoter has a DNA motif that is highly homologous to the consensus site for Zif268 and overlaps the SP1-binding site. Thus, zinc fingers 3 and 2 of Zif268 (ZF3 and ZF2) recognize two triplets in the 3'-end of the MDR1 SP1 site and can be used as anchors for selection of new zinc fingers (Fig. 1B). The basic strategy, outlined in Fig. 1C, was to use 2 Zif268 fingers to anchor the overall DNA binding module at a site overlapping the SP1 site, and then to use the yeast combinatorial library approach to sequentially select additional zinc fingers that would interact with bases 3' of the SP1 site in the MDR1 promoter. The newly selected zinc fingers could then be linked in various ways to native zinc finger domains to produce polyfinger proteins having high affinity and specificity. A more detailed description of the strategy and its results follows below.
For screening using the yeast one-hybrid system, various Zif constructs were fused via a spacer domain to the GAL4 transactivating domain and tested for their ability to activate reporters. We have selected two new zinc fingers, which recognize two triplets downstream of the SP1 site in the MDR1 promoter. This selection was performed in two steps using a sequential strategy for assembly of zinc finger proteins. At each step only one finger is added and randomized (optimized), "walking" along desired target. In the first step (Fig. 1C), the wild-type Zif 268 zinc fingers ZF2 and ZF3 were used as anchors and wild-type finger 1 (ZF1) was randomized at five potential base-contacting positions to generate the combinatorial library LR1 comprised of randomized fingers, RF1. The LR1 library consisted of 3.3 × 105 E. coli clones. Screening LR1 against the 3xMDR-HIS reporter (Fig. 2A) revealed a large number of positive clones of various size (about 1 positive clone per 300 library clones). For further analysis we picked six large clones, termed pLR1-1 through pLR1-6. These were tested for their ability to grow in the presence of increasing 3-AT concentrations. As shown in Fig. 2B, all clones (except pLR1-3) were able to grow even at 20 mM 3-AT. Similar results were obtained for a positive control comprised of yeast cells transformed with the pXCF3 plasmid that expresses a protein with three SP1 fingers, driving transcription of the W4-HIS reporter (Fig. 2A), which has four SP1 consensus sites (Cheng et al., 1997
1, for Leu and Pro at positions 1 and 5, and for Gly at
position 2. The selected residues in clones pLR1-3, pLR1-5, and pLR1-6
showed higher conservation, and the last two clones demonstrated better
reporter activation (Fig. 2B and data not shown). We arbitrarily chose
the pLR1-5 clone to create the next library, LR2. The newly selected
zinc finger encoded by pLR1-5 is henceforth termed NF1.
In the second step of screening (Fig. 1C), ZF2 and NF1 were used as
anchors to generate the LR2 library of randomized fingers, RF2. The RF2
proteins had the overall structure of ZF3 but were randomized at 4 potential base-contacting positions {1,2,3,5}. LR2 consisted of
5.4 × 104 E. coli clones. Screening
of LR2 against the 3xMDR target produced about one positive clone per
2000 library clones. We arbitrarily selected seven positive clones
(termed pLR2-1 through pLR2-7, expressing zinc fingers RF1-7) and
tested them. Figure 2C shows the summary result. pLR2-0 (anchor fingers
ZF2 and NF1, negative control) did not drive HIS3 nor
lacZ transcription. All selected LR2 plasmids activated
HIS3 gene transcription, but less efficiently as compared
with that of pLR1-5 (they could not grow in the presence of 20 mM
3-AT). All tested LR2 plasmids also specifically activated expression
of lacZ with the 3xMDR target but not with the W4 target. Sequence analysis of RF2 in selected clones revealed substantial conservation of the residues in the randomized positions. The most
conserved residues at positions 1, 2, 3, and 5 were Lys, His, Asn, and
Thr, respectively (Fig. 2C). Interestingly, zinc finger proteins
selected by phage display against XAX triplets also usually have Asn at
position 3 (Wolfe et al., 1999Analysis of the Specificity of Novel Polyfinger Proteins.
We
next analyzed the ability of the newly selected zinc fingers to
participate in regulation of gene expression in yeast. The newly
selected fingers were coupled in various ways with native SP1 or Zif268
zinc fingers and tested against reporters containing MDR1 or consensus
SP1 targets (Fig. 3A). The DNA binding affinity of zinc finger proteins
can be significantly increased by generation of polyfinger peptides
(Beerli et al., 1998
; Kim and Pabo, 1998
). We have designed novel four-
(p4F) and five-finger (p5FS and p5FL) polypeptides to interact with the
MDR1 promoter (Fig. 3B). It is known that length of the linker
connecting the fingers in polyfinger proteins can significantly affect
DNA binding properties (Kim and Pabo, 1998
). Thus, we designed two
types of linkers for connection of two sets of fingers in five-finger
proteins. In the p5FS construction, the linker was the canonical
sequence (TGEKP) that is usual for native Zif proteins. In another
plasmid, p5FL, the linker was extended with several glycine residues to
provide additional spacing and flexibility (TGEKGGGGERP).
-galactosidase activities in cells containing lacZ
reporters and expressing zinc finger proteins. Except for p5FS, all
zinc finger constructs selectively induced
-galactosidase expression
from the reporter driven by the MDR5 target as opposed to the SP1
target. The four-finger protein encoded by p4F stimulated MDR5-lacZ expression 375-fold above background (activation
by pXC empty vector) and 37.5-fold above the level of
SP1-lacZ expression, indicating a high degree of
discrimination between the MDR target and the SP1 site. Other proteins
stimulated MDR5-lacZ expression 80- to 225-fold above
background, and 45- to 160-fold above stimulation of
SP1-lacZ. Moreover, the levels of SP1-lacZ
expression stimulated by pLR2-1 or p5FL were about equal to background,
indicating that the resultant proteins are highly specific for the MDR
target as compared with the SP1 consensus site. A lack of
discrimination between MDR and SP1 sites was observed only for p5FS,
which encodes the five-finger peptide with the canonical linker; this
construct strongly activated reporters driven by both types of sites.
|
Activation or Repression of the MDR1 Promoter by Artificial
Transcription Factors.
To determine whether the newly selected
zinc finger proteins could modulate transcription driven by the MDR1
promoter in mammalian cells, we subcloned coding sequences for the new
zinc finger proteins into eukaryotic expression vectors based on
pcDNA3, and fused them with a nuclear localization sequence and with
various mammalian effector domain sequences (Fig.
5A). These were cotransfected into human
KB-8-5 cells together with luciferase reporters driven by various
upstream target sequences (Fig. 5B). Figure
6A shows that the novel zinc finger
peptides fused to the VP16 transactivation domain specifically
stimulated transcription of a reporter with an MDR1 upstream target
(2xMDR) but not a reporter with an irrelevant target (5xGAL4). The
levels of activation of 2xMDR-LUC transcription above that of
5xGAL4-LUC were from 210- to 463-fold for the novel zinc finger
peptides described above, and 43-fold for SP1 fingers. Compared with
the 5xGAL4-LUC reporter, the 2xMDR-LUC reporter was also activated
25-fold by endogenous cellular/serum factors, as evidenced by the
expression seen on transfection with the pcDNA3 control vector.
|
|
88/+105) of the native MDR1 promoter (up to 1.5-fold inhibition).
However, as seen in Fig. 7C, addition of one or two copies of the
KRAB-A repression domain resulted in much stronger inhibition of
2xMDR-LUC expression. For example, the pcK2-5F construct, which
expresses 2 KRAB-A domains in association with the five zinc finger
module having the long linker, produced a 22-fold repression. The four-
and five-finger constructs also provided moderate repression of the
native MDR
88/+105 reporter (up to 4-fold) (Fig. 7D). Interestingly,
the repression properties of three-finger proteins were not improved by
fusion to KRAB-A domains, suggesting that they do not permit effective
deployment of the repressor; this may possibly be due to their
relatively weak binding as compared with the multifinger proteins. We
also showed that MDR-targeted proteins with two KRAB-A domains did not
repress transcription from the 2xSP1 reporter, whereas SP1 zinc fingers
fused to the KRAB-A domains were able to repress, thus demonstrating
selectivity (Fig. 7E). Western blotting with an antibody to the Myc
epitope included in each of these constructs demonstrated that the
newly selected zinc finger proteins are expressed at comparable levels
(within 2- to 3-fold) in KB-8-5 cells (data not shown). Thus, the
differential repressor actions of the various constructs used are due
to differences in innate effectiveness rather than to differences in
protein expression levels.
|
Repression of TPA-Inducible P-glycoprotein Expression from a
Chromosomal Gene.
Although transactivators and repressors selected
by phage library techniques have previously been shown to be able to
regulate expression of reporter gene constructs, this approach has not yet been extended to the regulation of endogenous chromosomal genes.
This is an important issue, because DNA in an episomal reporter gene
target is not likely to be fully organized into the nucleosomes and
higher order structures found in chromatin (Kadonaga, 1998
). To pursue
this issue, we examined the effects of one of our novel transcriptional
repressors on P-glycoprotein expression in K562 cells. In these cells
the expression of P-glycoprotein from the MDR1 locus can be induced by
the EGR1 transcription factor in response to TPA treatment (McCoy et
al., 1995
, 1999
). We transiently transfected K562 cells with the
pcK2-5F repressor plasmid, or empty vector, and induced the
transcription of MDR1 using TPA. Cell surface expression of the
P-glycoprotein was quantitated by antibody staining and flow cytometry,
whereas cell surface expression of the integrin
5
1 served as a
specificity control. The transfected cells were identified by
expression of a cotransfected GFP marker. In K562 cells, TPA treatment
resulted in a modest but clear-cut increase in the cell surface
expression of P-glycoprotein, as indicated by a right-shift of the flow
cytometry profile (Fig. 8A). As seen in
Fig. 8B, transfection with the pcK2-5F repressor plasmid very
effectively inhibited the TPA-inducible expression of P-glycoprotein.
Thus, the P-glycoprotein flow cytometry profile in the pcK2-5F
transfected and TPA-induced cells was similar to, or even left-shifted
from, the profile seen in the uninduced cells. The few cells that still
expressed high levels of P-glycoprotein may reflect a population of
cells transfected with the plasmid expressing GFP and not transfected
with the plasmid expressing the repressor. Importantly, pcK2-5F did not
affect the expression profile of the
5
1 integrin (Fig. 8,
C and D), indicating that inhibition of P-glycoprotein expression by
pcK2-5F was due to specific repression and not due to any general
inhibitory effect on expression of membrane proteins. It is important
to note that the promoters for both
5 and
1 contain one or more SP1 sites (Birkenmeier
et al., 1991
; Cervella et al., 1993
); thus, the
5
1 integrin is a very
suitable specificity control.
|
| |
Discussion |
|---|
|
|
|---|
In this study, we have investigated the possibility of regulating the human MDR1 gene using artificial transcription factors. We designed novel zinc finger DNA binding modules that specifically interact with the MDR1 promoter, overlapping an important regulatory site. These modules are hybrid proteins that consist of native SP1 and Zif268 zinc fingers linked to novel zinc finger peptides selected using a yeast combinatorial library approach. One of the valuable aspects of the yeast library screening system is that it allows direct selection of DNA binding modules that can function in a cellular environment, where the DNA target is decorated with histones and other proteins. This approach may confer some advantages over phage display approaches where the selection of DNA binding entities is initially done with a "naked" DNA target; thus the phage-selected DNA binding modules must then be retested for the ability to function in cells. It was initially surprising that, in the absence of any counter-selection system, most of the "hits" that emerged from screening our libraries in yeast represented plasmids coding for proteins that are quite specific in their DNA recognition abilities. This contrasts with phage display, where selection of specific DNA-binding polypeptides is contingent on counter-selection against a background of competing nonspecific DNA. A possible explanation is that in the yeast system plasmids coding for proteins displaying nonspecific DNA interactions result in toxicities due to simultaneous inappropriate activation of multiple genes and are thus lost from the selection process.
The screening processes reported here were done with relatively small
libraries (as compared with phage libraries). However, the libraries
were sufficiently large to approximate the maximum number of
possibilities at the zinc finger residues known to be involved in
direct DNA interaction. This was achieved, in part, by using a
sequential strategy for selection of zinc fingers, thus walking along
the target sequence. Sequential selection is also useful in that it may
eliminate problems of steric interference, and yield sets of zinc
fingers that can work effectively together (Kim and Pabo, 1998
). It
should be noted that because a great deal of information is available
about specificities of zinc fingers, in some instances it may be
possible to design new DNA-binding proteins by directly mixing zinc
fingers with known specificities (Beerli et al., 1998
). However, it is
still difficult to predict subtle effects of protein-protein and
protein-DNA interference when combining individual zinc fingers into a
polyfinger protein (Kim and Pabo, 1998
; Wolfe et al., 1999
).
Although sequential selection seems ideal, pragmatic considerations
often dictate the use of a mixed strategy, where newly selected zinc
fingers derived from library screening are combined with well
characterized zinc fingers from native transcription factors, to permit
the rapid assembly of multizinc finger proteins that can selectively
bind to relatively long stretches of DNA. This modular assembly
approach has been used in the present investigation, as well as in
previous studies with zinc finger modules derived from screening by
phage display (Beerli et al., 1998
; Kim and Pabo, 1998
; Wolfe et al.,
1999
). It seems quite clear, however, that relatively subtle changes in
the mode of assembly of multizinc finger proteins can result in major
differences in biological activity. For example, we found that use of
an extended linker region in five zinc finger proteins, as opposed to
the canonical linker, can make an enormous difference in terms of
selectivity. These observations somewhat resemble previous work
indicating that the type of linker used can strongly influence the
overall properties of multizinc finger proteins (Kim and Pabo, 1998
). However, in that instance the choice of linker had a major impact on
affinity, whereas in our studies the linker mainly affected selectivity. Thus, subtle aspects of protein conformation seem to be
able to outweigh simple addition of binding modules.
The DNA target for which we generated novel zinc finger proteins is an
important site in the MDR1 promoter that can be regulated by the SP1,
EGR1, and WT1 transcription factors in different types of mammalian
cells. Several of our novel zinc finger-effector-activator domain
chimeras provided strong and highly selective transactivation of
reporter genes driven by model promoters containing the MDR1 target
site, both in yeast and in mammalian cells. In our experiments on
repression of luciferase reporters in mammalian cells, the selected
proteins were only moderately effective in blocking transcription by
simple mass action competition for promoter sites. However, the
addition of the KRAB-A repressor domain resulted in significant enhancement of repression by the novel four and five zinc finger proteins. Expression from model promoters containing TATA boxes was
almost completely repressed by our novel DNA-binding proteins fused to
KRAB-A. The repression of a reporter driven by a portion (
88/+105) of
the native MDR1 promoter, which lacks a TATA box, was less dramatic.
This is likely due to the fact that the KRAB-A domain represses most
efficiently at promoters where initiation is dependent on the presence
of a TATA element (Pengue and Lania, 1996
). Thus, although simple
masking of the target site in the MDR1 promoter did not result in
strong inhibition of its transcription, the use of additional active
repressor domains can significantly enhance repression, in agreement
with previous reports (Beerli et al., 1998
).
Although previous studies have successfully used phage techniques to
create novel transcriptional regulators that function in mammalian
cells, these novel proteins were exclusively evaluated in the context
of transient transfection reporter gene assays (Choo et al., 1997
; Kim
and Pabo, 1997
, 1998
; Beerli et al., 1998
). There are substantial
differences in the organization of DNA in episomes, such as reporter
constructs, versus the organization of chromosomal DNA. This includes a
relative lack of nucleosomes and higher order structures in episomes,
and different responsiveness to histone acetylases and deacetylases
(Sheridan et al., 1997
; Kadonaga, 1998
). Thus, it seemed important to
evaluate the ability of our novel repressors to regulate expression of
an endogenous chromosomal gene. It was significant to find that one of
our MDR1 repressor constructs could effectively block TPA-mediated
induction of P-glycoprotein expression in K562 cells, without affecting expression of another membrane protein. The success of this initial effort to target a chromosomal gene may be based on the fact that the
yeast system inherently selects DNA binding modules that function well
in the in vivo setting. The current findings demonstrate the ability to
block a TPA-induced increase in P-glycoprotein expression. Actual
reversal of multidrug resistance in tumor cells will require a far more
prolonged expression of the repressor protein. This could be attained
by stable transfection of drug-resistant cells with the repressor
plasmid. However, more therapeutically significant approaches might
include the development of a viral vector system for gene therapy
(Verma and Somia, 1997
), or use of technology for the direct
intracellular delivery of functional proteins (Nagahara et al., 1998
).
These approaches are currently under investigation.
| |
Acknowledgments |
|---|
We are deeply indebted to Dr. Marilyn Cornwell for the provision of reporter plasmids and cell lines. We also thank Dr. Xiaojun Cheng for valuable advice during the initial phases of this project.
| |
Footnotes |
|---|
Received November 2, 1999; Accepted February 25, 2000
This work was supported by National Institutes of Health Grant CA77340 (to R.L.J.).
Send reprint requests to: Dr. R. L. Juliano, Department of Pharmacology, CB# 7365, 1106 Jones Bldg., School of Medicine, University of North Carolina, Chapel Hill, NC 27599-7365. E-mail: arjay{at}med.unc.edu
| |
Abbreviations |
|---|
3-AT, 3-amino-1,2,4 triazole; TPA, 12-O-tetradecanoylphorbol-13-acetate; MDR, multidrug resistance; GFP, green fluorescent protein.
| |
References |
|---|
|
|
|---|
5
1 fibronectin receptor. Characterization of the
5
1 gene promoter.
J Biol Chem
266:
20544-20549
1-integrin gene expression is regulated by two promoter regions.
J Biol Chem
268:
5148-5155
Promises, problems and prospects.
Nature (Lond)
389:
239-242[Medline].This article has been cited by other articles:
![]() |
V. Dixit and R. L. Juliano Selective Killing of Smad4-Negative Tumor Cells via a Designed Repressor Strategy Mol. Pharmacol., July 1, 2008; 74(1): 289 - 297. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Durai, M. Mani, K. Kandavelou, J. Wu, M. H. Porteus, and S. Chandrasegaran Zinc finger nucleases: custom-designed molecular scissors for genome engineering of plant and mammalian cells Nucleic Acids Res., October 26, 2005; 33(18): 5978 - 5990. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. L. Juliano, V. R. Dixit, H. Kang, T. Y. Kim, Y. Miyamoto, and D. Xu Epigenetic manipulation of gene expression: a toolkit for cell biologists J. Cell Biol., June 20, 2005; 169(6): 847 - 857. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Blancafort, D. J. Segal, and C. F. Barbas III Designing Transcription Factor Architectures for Drug Discovery Mol. Pharmacol., December 1, 2004; 66(6): 1361 - 1371. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Asakura, H. Uchida, H. Miyachi, H. Kobayashi, Y. Miyakawa, S. D. Nimer, H. Takahashi, Y. Ikeda, and M. Kizaki TEL/AML1 Overcomes Drug Resistance Through Transcriptional Repression of Multidrug Resistance-1 Gene Expression Mol. Cancer Res., June 1, 2004; 2(6): 339 - 347. [Abstract] [Full Text] [PDF] |
||||
![]() |
P.-Q. Liu, M. F. Morton, A. Reik, R. de la Rosa, M. C. Mendel, X.-Y. Li, C. C. Case, C. O. Pabo, V. Moreno, A. Kempf, et al. Cell Lines for Drug Discovery: Elevating Target-Protein Levels Using Engineered Transcription Factors J Biomol Screen, February 1, 2004; 9(1): 44 - 51. [Abstract] [PDF] |
||||
![]() |
T. G. Uil, H. J. Haisma, and M. G. Rots Therapeutic modulation of endogenous gene function by agents with designed DNA-sequence specificities Nucleic Acids Res., November 1, 2003; 31(21): 6064 - 6078. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. V. Bartsevich, J. C. Miller, C. C. Case, and C. O. Pabo Engineered Zinc Finger Proteins for Controlling Stem Cell Fate Stem Cells, November 1, 2003; 21(6): 632 - 637. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Tan, D. Guschin, A. Davalos, Y.-L. Lee, A. W. Snowden, Y. Jouvenot, H. S. Zhang, K. Howes, A. R. McNamara, A. Lai, et al. Zinc-finger protein-targeted gene regulation: Genomewide single-gene specificity PNAS, October 14, 2003; 100(21): 11997 - 12002. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Xu, D. Falke, and R. L. Juliano P53-Dependent Cell-Killing by Selective Repression of Thymidine Kinase and Reduced Prodrug Activation Mol. Pharmacol., August 1, 2003; 64(2): 289 - 297. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Falke, M. Fisher, D. Ye, and R. L. Juliano Design of artificial transcription factors to selectively regulate the pro-apoptotic bax gene Nucleic Acids Res., February 1, 2003; 31(3): e10 - e10. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Xu, D. Ye, M. Fisher, and R. L. Juliano Selective Inhibition of P-glycoprotein Expression in Multidrug-Resistant Tumor Cells by a Designed Transcriptional Regulator J. Pharmacol. Exp. Ther., September 1, 2002; 302(3): 963 - 971. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Ren, T. N. Collingwood, E. J. Rebar, A. P. Wolffe, and H. S. Camp PPARgamma knockdown by engineered transcription factors: exogenous PPARgamma 2 but not PPARgamma 1 reactivates adipogenesis Genes & Dev., January 1, 2002; 16(1): 27 - 32. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. W. Scotto and R. A. Johnson Transcription of MDR1: A Therapeutic Target Mol. Interv., June 1, 2001; 1(2): 117 - 125. [Abstract] [Full Text] [PDF] |
||||
![]() |
R.L. Juliano, A. Astriab-Fisher, and D. Falke Macromolecular Therapeutics: Emerging Strategies for Drug Discovery in the Postgenome Era Mol. Interv., April 1, 2001; 1(1): 40 - 53. [Abstract] [Full Text] |
||||
![]() |
P.-Q. Liu, E. J. Rebar, L. Zhang, Q. Liu, A. C. Jamieson, Y. Liang, H. Qi, P.-X. Li, B. Chen, M. C. Mendel, et al. Regulation of an Endogenous Locus Using a Panel of Designed Zinc Finger Proteins Targeted to Accessible Chromatin Regions. ACTIVATION OF VASCULAR ENDOTHELIAL GROWTH FACTOR A J. Biol. Chem., March 30, 2001; 276(14): 11323 - 11334. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||