Toxic peptides and genes encoding toxin γ of the Brazilian scorpions Tityus bahiensis and Tityus stigmurus
B BECERRIL, M CORONA, FIV CORONAS… - Biochemical …, 1996 - portlandpress.com
… separation of fraction IV from Sephadex G-50 … IV-5 of T. serrulatus (KKDGYPVEYDNCAYICWNYDNAYCDKLCKD…)
and for this reason was called toxin IV-5-stigmurus (abbreviated to IV…
and for this reason was called toxin IV-5-stigmurus (abbreviated to IV…
[HTML][HTML] Mass Fingerprinting of the Venom and Transcriptome of Venom Gland of Scorpion Centruroides tecomanus
…, MT Romero-Gutiérrez, FIV Coronas… - PloS one, 2013 - journals.plos.org
Centruroides tecomanus is a Mexican scorpion endemic of the State of Colima, that causes
human fatalities. This communication describes a proteome analysis obtained from milked …
human fatalities. This communication describes a proteome analysis obtained from milked …
Characterization of venom components from the scorpion Androctonus crassicauda of Turkey: peptides and genes
F Caliskan, BI García, FIV Coronas, CVF Batista… - Toxicon, 2006 - Elsevier
The soluble venom from the scorpion Androctonus crassicauda was fractionated by high
performance liquid chromatography. At least 44 different sub-fractions were resolved and …
performance liquid chromatography. At least 44 different sub-fractions were resolved and …
Toxin gamma from Tityus serrulatus scorpion venom plays an essential role in immunomodulation of macrophages
VL Petricevich, AH Cruz, FIV Coronas, LD Possani - Toxicon, 2007 - Elsevier
Fraction number II obtained from Sephadex G-50 gel filtration of the soluble venom from the
Brazilian scorpion Tityus serrulatus (TSV) stimulates macrophage function in vitro. The aim …
Brazilian scorpion Tityus serrulatus (TSV) stimulates macrophage function in vitro. The aim …
A large number of novel Ergtoxin‐like genes and ERG K+‐channels blocking peptides from scorpions of the genus Centruroides
…, B Garcı́a, ME Ramı́rez-Domı́nguez, FIV Coronas… - FEBS …, 2002 - Wiley Online Library
Twenty‐three novel sequences similar to Ergtoxin (ErgTx) were obtained by direct
sequencing of peptides or deduced from gene cloned using cDNAs of venomous glands of …
sequencing of peptides or deduced from gene cloned using cDNAs of venomous glands of …
[HTML][HTML] The Cuban scorpion Rhopalurus junceus (Scorpiones, Buthidae): component variations in venom samples collected in different geographical areas
R Rodríguez-Ravelo, FIV Coronas… - Journal of venomous …, 2013 - SciELO Brasil
Backgound The venom of the Cuban scorpion Rhopalurus junceus is poorly study from the
point of view of their components at molecular level and the functions associated. The …
point of view of their components at molecular level and the functions associated. The …
Venom characterization of the Amazonian scorpion Tityus metuendus
…, JG Martins, R Restano-Cassulini, FIV Coronas… - Toxicon, 2018 - Elsevier
The soluble venom from the scorpion Tityus metuendus was characterized by various
methods. In vivo experiments with mice showed that it is lethal. Extended electrophysiological …
methods. In vivo experiments with mice showed that it is lethal. Extended electrophysiological …
General biochemical and immunological characterization of the venom from the scorpion Tityus trivittatus of Argentina
AR de Roodt, FIV Coronas, N Lago, ME González… - Toxicon, 2010 - Elsevier
Tityus trivittatus is the Argentinean scorpion reported to cause the majority of human fatalities
in the country, however no systematic studies have been conducted with the venom of this …
in the country, however no systematic studies have been conducted with the venom of this …
Biochemical and biological activities of the venom of the Chinese pitviper Zhaoermia mangshanensis, with the complete amino acid sequence and phylogenetic …
D Mebs, U Kuch, FIV Coronas, CVF Batista… - Toxicon, 2006 - Elsevier
Zhaoermia mangshanensis (formerly Trimeresurus mangshanensis, Ermia mangshanensis)
represents a monotypic genus of pitviper known only from Mt Mang in China's Hunan …
represents a monotypic genus of pitviper known only from Mt Mang in China's Hunan …
Comparative proteomic analysis of male and female venoms from the Cuban scorpion Rhopalurus junceus
R Rodríguez-Ravelo, CVF Batista, FIV Coronas… - Toxicon, 2015 - Elsevier
A complete mass spectrometry analysis of venom components from male and female scorpions
of the species Rhophalurus junceus of Cuba is reported. In the order of 200 individual …
of the species Rhophalurus junceus of Cuba is reported. In the order of 200 individual …