Table 1

Peptide agonists and antagonists

LigandAmino Acid Sequence
Rat amylin1-a NNLGP
S    V
S    L
RKCNTATCATQRLANFLV    PPTNVGSNTYNH2
Porcine CAL1-a CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETPNH2
Rat CGRP1-a GVVKD
G    N
S    F
SCNTATCVTHRLLAGLLSR    VPTNVGSEAFNH2
hCAL1-a CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPNH2
Rat CAL1-a CGNLSTCMLGTYTQNKNKFHTFPQTSIGVGAPNH2
Eel CAL1-a CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTPNH2
AC661-b VLGKLSQELHKLQTYPRTNTGSGTPNH2
AC5121-b (Ac)LGXLSQELHRLQTYPRTNTGSNTYNH2
AC251-b VTHRLAGLLSRSGGVVKNNFVPTNVGSKAFNH2
PYY1-a YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRYNH2
  • 1-a Full agonist.

  • 1-b Antagonist in nonconstitutively activated system (Chen et al., 1996).