TABLE 1

Tested mutants of Hhn2b with indication of the mutated residue, the IC50 value obtained by automated patch clamp, the hill slope for the fit of the curve, and the number of repeats for each determined curve

PeptideAmino Acid SequenceIC50Hill Slopen
µM
Hhn2bAECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL>106
Hhn2b-K4LAECLGFGKSCVPGKNECCSGYACNSRDKWCKVLL>103
Hhn2b-G7WAECKGFWKSCVPGKNECCSGYACNSRDKWCKVLL2.7 ± 0.41.5 ± 0.55
Hhn2b-N24SAECKGFGKSCVPGKNECCSGYACSSRDKWCKVLL4.0 ± 0.51.3 ± 0.24
Hhn2b-V32WAECKGFGKSCVPGKNECCSGYACNSRDKWCKWLL>104
Hhn2b-G7W/N24AAECKGFWKSCVPGKNECCSGYACASRDKWCKVLL8.6 ± 1.71.4 ± 0.46
Hhn2b-G7W/N24SAECKGFWKSCVPGKNECCSGYACSSRDKWCKVLL0.44 ± 0.041.3 ± 0.15
Hhn2b-G7W/N24S/W29AAECKGFWKSCVPGKNECCSGYACSSRDKACKVLL>106
Hhn2b-G7W/N24S/W29FAECKGFWKSCVPGKNECCSGYACSSRDKFCKVLL1.0 ± 0.21.0 ± 0.24