TABLE 3

Sequences of several widely used CPPs

CategoriesNamesSequencesOriginReferences
CenR motifiRGDCRGDKGPDECM proteinsSugahara et al., 2010
CationicNonaarginineR9SyntheticWalrant et al., 2011
TATYGRKKRRQRRRHuman immunodeficiency virus (HIV) type 1Takeshima et al., 2003
HydrophobicK-FGFAAVALLPAVLLALLAPK-FGFDokka et al., 1997
FGF-12PIEVCMYREPFGF-12Nakayama et al., 2011
AmphipathicAntpRQIKIWFQNRRMKWKKThird helix of the antennapedia homeodomainDerossi et al., 1994
pVECLLIILRRRIRKQAHAHSKMurine vascular endothelial-cadherin proteinElmquist et al., 2006
PenetratinRQIKIWFQNRRMKWKKAntennapedia homoeodomain in DrosophilaAmand et al., 2008
TP10AGYLLGKINLKALAALAKKILSynthetic peptideIslam et al., 2014
M918MVTVLFRRLRIRRACGPPRVRVTumor suppressor protein p14RFEl-Andaloussi et al., 2007
VP22NAKTRRHERRRKLAIERHerpesvirus structural proteinElliott and O'Hare, 1997
SAPVRLPPPVRLPPPVRLPPPSyntheticFernández-Carneado et al., 2004
MPGGALFLGFLGAAGSTMGAWSQPKKKRKVCombination of hydrophobic domain from HIV GP41 and NLS of SV40 large T antigenMorris et al., 2008
Pep-1KETWWETWWTEWSQPKKKRKVCombination of reverse transcriptase of HIV-1 and NLS of SV40 large T antigenMorris et al., 2008
S413-PVALWKTLLKKVLKAPKKKRKVCombination of DernaSeptin S4 peptide with NLS of SV40 large T antigenHariton-Gazal et al., 2002
  • NLS, nuclear localization signa; SV40, simian virus 40; TP-10, transportan 10.